Signal Peptide Selection for the Efficient Periplasmic and Secretive Expression of Recombinant Brazzein in Escherichia Coli

All published articles of this journal are available on ScienceDirect.

RESEARCH ARTICLE

Signal Peptide Selection for the Efficient Periplasmic and Secretive Expression of Recombinant Brazzein in Escherichia Coli

The Open Biotechnology Journal • 30 Nov 2023 • RESEARCH ARTICLE • DOI: 10.2174/0118740707270318231123100233

Abstract

Background:

The high production cost and difficulty of functional expression of brazzein are the limiting factors, making the development of inexpensive, scalable technologies critical for their successful implementation in the market. Secretory expression allows functional expression of the S-S bond-rich proteins and facilitates the purification procedure, resulting in lower processing costs. However, extensive screening and optimization of multiple signal peptides are required to ensure the successful secretion of recombinant proteins.

Objective:

We studied the expression of the minor type of brazzein using 21 different signal peptides in Escherichia coli and investigated their ability to direct the target protein into periplasmic space and culture medium.

Methods:

The synthetic genes were cloned into the pSEVA234 vector under the inducible Trc promoter and initial micro-scale expression analysis was conducted at two distinct conditions followed by scale-up and purification of the selected signal peptides with secretive abilities.

Results:

Two signal peptides led to the secretion of the target protein. The yields of the target protein for MalE_Brazzein and HstI_Brazzein in the periplasm were 11.33 mg/L and 52.33 mg/L, and those in the culture media were 3.975 mg/L and 7.73 mg/L, respectively.

Conclusion:

This study will provide insights into the identification of optimal signal peptides for secretive brazzein expression in E.coli and demonstrate that the abovementioned two signal peptides can be used for successful extracellular production of the target protein in this host.

Keywords: Brazzein, Sweet proteins, Signal peptides, Protein expression, E.coli, SP screening.

1. INTRODUCTION

The potential impact of sucrose on glucose homeostasis and its adverse effects are now better understood [1], and the dramatic increase in diabetes and obesity over the past few decades [2] has shifted interest toward ultra-low-calorie, healthful alternatives derived from natural sources. One of these alternatives is sweet proteins, which are up to a few thousand times sweeter than sucrose, do not affect glucose homeostasis, have low energetic value, and are bioengineerable. Brazzein, the smallest known sweet protein to date, was first found in the fruit of Pentadiplandra brazzeana in 1994. Two types of brazzein exist in nature: i) the major form, which has 54 amino acid residues and is 500 times sweeter than sucrose by weight, and ii) the minor form, which lacks the first pyroglutamic acid residue [3]. The latter is two times sweeter than the major form [4]. Brazzein is the most attractive from an industrial standpoint due to its broad pH range, high-temperature stability [3], and sweet taste similar to sucrose [5]. However, the formation of disulfide bonds in recombinant brazzein is crucial for maintaining these properties [4, 6, 7], and yet cytoplasmic expression in E.coli resulted in the formation of inclusion bodies that required further treatment for the recovery of sweet taste [8]. The lack of favorable conditions and mechanisms for the formation of disulfide bonds makes it challenging to obtain the functional form of S-S bond-rich proteins in the cytoplasm of E. coli cells. The periplasm of E. coli, on the other hand, is characterized by an oxidative environment and chaperones involved in the formation and correction of disulfide bonds [9]. Multiple strains have been engineered to form disulfide bonds in the cytoplasm effectively. For instance, researchers reported superior brazzein production in the cytoplasm of T7 SHuffle cells than in BL21 (DE3) strain cells [10]. Another team developed the CyDisCoTM-system by expressing yeast mitochondrial Erv1p and DsbC chaperones using the pLysS backbone in the cytoplasm and implemented it for intracellular brazzein expression [11]. Although this approach allows for the expression of functional recombinant proteins in large quantities, periplasmic or secretive expression offers various advantages, including the ease of purification and the inhibition of protease attack, in addition to accurate folding [12, 13]. In fact, several commercialized Fab fragments and pharmaceutical products at the clinical stage are produced by periplasmic secretion in E. coli [14, 15].

Notwithstanding these benefits and achievements, the limited effectiveness of protein secretion into the extracellular medium in E. coli remains a significant limitation that necessitates the selection of appropriate signal peptides and an extensive optimization process [16]. For instance, Santos, B.D. et al. (2019) successfully enhanced the periplasmic export of small metal-binding protein in E. coli through the screening of different signal peptides [17]. Another team created an antibiotic-based screening approach for optimizing a signal peptide library for periplasmic expression of a single chain variable (scFv) antibody fragment by employing β-lactamase as a C-terminal reporter of periplasmic localization. The method linked scFv translocation to β-lactamase potency and enhanced signal peptides raised periplasmic scFv activity by about 40% [18]. Such technologies greatly expand screening throughput and minimize labour in the selection process. Additionally, robust in silico tools are developed to aid the selection of appropriate signal peptides [19, 20].

In this work, we tried to screen and select different signal peptides suitable for localizing recombinant brazzein in the periplasmic space and directing it to culture media in E.coli. Initially, signal peptides were screened using bioinformatics tools and twenty-one genes conjugated with selected signal peptide coding sequences were designed, and codons were optimized for E.coli to balance codon usage. Synthesized synthetic genes were cloned into the pSEVA234 vector by the restriction-ligation method. The generated constructs were transformed into the E.coli NEB Express strain and microscale expression studies were then carried out under two distinct conditions to evaluate and compare the impact of the selected signal peptides on the synthesis and localization of the target protein. Then, the expression of two selected constructs based on secretive ability was scaled up and recombinant brazzein was purified by nickel affinity chromatography. Finally, the yield of the target protein in the periplasmic space and culture medium was measured.

2. MATERIALS AND METHODS

2.1. BacteRial Strains, Plasmids, Antibodies and Columns

The E.coli strain NEB Express (C2523I) was used as an expression host from NEB Company (USA). The pSEVA 234 expression plasmid used in this work was provided by the SEVA repository (Lorenzo Lab, Spain). For Western blot analysis, 6x-His Tag Recombinant Rabbit Monoclonal Antibody (RM146) from Thermo Scientific (USA) and Anti-Rabbit IgG (A3687)–Alkaline Phosphatase antibody produced in goat (Merck, Germany) were used and stained with NBT/BCIP Stock Solution (Roche Switzerland). Recombinant brazzein was purified using prepacked 1 mL Complete™ His-Tag Purification Columns purchased from Roche (Switzerland).

2.2. Signal Peptide Selection

First, signal peptide sequences suitable for Escherichia coli K-12 strain and some other common bacterial signal peptides were extracted from the signalpeptide.de database. The cutting efficiency of these signal peptides in the production of brazzein protein was evaluated using the SignalP5.0 program that distinguishes diverse signal peptides based on a deep neural network approach [19]. Signal peptides with a high probability of being cleaved at the correct amino acid positions were chosen for the experimental study. While selecting, we also tried to include signal peptides from various pathways. The localization and solubility of the fused recombinant proteins were subsequently analyzed using the ProtComp Version 9 [20] and Protein-Sol [21] software programs, respectively. The ProtCompB server integrates many protein localization prediction methods, including neural network-based prediction and direct comparison with bases of homologous proteins with established localization, and it can predict five possible destinations for Gram-negative bacteria. Protein-Sol scales solubility ranges from 0 to 1 where a value nearest to one being the most soluble. The Protein-Sol server scales solubility from 0 to 1 and interprets the results using the experimental solubility dataset, where any value more than 0.45 is projected to have better solubility than the average soluble E.coli protein [21, 22].

2.3. Designing and Construction Of Expression Vectors

Brazzein sequence was retrieved from the UniProt database (P56552 · DEF_PENBA), and the first amino acid pyroglutamate was removed from the sequence and codon optimized for E.coli using IDTDNA’s codon optimization tool [23]. Further ribosome binding site and codon-optimized signal peptide-coding sequences were added to the N-terminal side, while the 6x His-tag sequence was included in the C-terminus for easy visualization and purification. In addition, to facilitate cloning the genes into pSEVA234 EcoRI and XbaI enzyme sites were added to the 5ʹ and 3ʹ ends of the gene, respectively (Fig. 1). The genes were synthesized, and sequences were confirmed by Synbio Tech (USA).

Fig. (1). Schematic structure of the constructs used in this work.

2.4. Transformation and Positive Clone Screening

The prepared constructs were further transformed into NEB Express strain for expression. For this reason, the plasmids were first diluted to a concentration of 10 ng/μl and 20 ng of plasmid DNA was added to 50 µl chemically competent E.coli cells. The transformants were grown on Luria Bertani (LB) agar Petri plates overnight after chemical transformation [24], and for each plasmid, two colonies were picked and separately transferred into 2 mL kanamycin-containing LB medium and grown for approximately 16 h. After this step, part of the culture was subjected to plasmid purification, and glycerol stocks were prepared accordingly.

The presence of the synthetic gene in plasmids isolated from transformed colonies was confirmed by PCR analysis. Q5 polymerase enzyme and buffers (NEB, USA) were used for PCR [25]. Primers designed for the backbone of plasmid pSEVA234 were used: Forward GTTCTGGCAAATATTCTG AAATGAGCTG and Reverse CAAGACTAGTCGCCAGGGT TTTCC. PCR products were analyzed using 1% agarose gel in electrophoresis.

2.5. Protein Expression and Western Blot Analysis

Transformed E.coli NEB Express stocks were thawed at room temperature and a 5 µL stock sample was inoculated into 295 µL kanamycin containing (50 µg/mL) LB medium and grown overnight at 37°C with agitation at 1000 rpm in a 2 mm orbital microplate shaker. Then, 10 µL of this starter culture was transferred to 290 µL LB media (kanamycin: 50 µg/mL) and grown until the OD600 value reached 0.4-0.6 at 37°C with 1000 rpm agitation. Brazzein expression was initiated with 0.5 mM IPTG and conducted under two different conditions: 37°C for 4 hours (h) and 25°C for 16 h. After expression, three types of samples: 1st culture – 50 µL; 2nd supernatant – 100 µL; and 3rd cell pellet from 200 µL culture were collected. All samples were kept at -80°C and used within a week except the culture, which was immediately prepared for electrophoresis by adding equal amounts of 2x Laemmli buffer. The supernatant was first concentrated using a vacuum concentrator before applying for the electrophoresis analysis. The periplasmic expression was checked by extracting proteins through an osmotic shock procedure. The cell pellet was first resuspended in 200 µL of room temperature TES buffer (50 mM Tris-HCl, 10 mM EDTA, and 20% sucrose) and centrifuged at 7 000 x*g for 10 minutes at 4°C. After discarding the supernatant, the pellet was treated with 50 µL of ice-cold TE buffer (50 mM Tris-HCl, 10 mM EDTA) and incubated for 30 minutes on ice, followed by subsequent centrifugation. The taken protein extract was subjected to gel electrophoresis assay accordingly. After running gels, proteins were transferred to nitrocellulose membranes (Cytiva, Sweden), and western blot analysis was performed using the standard methodology [24], diluting antibodies according to the manufacturers’ recommendations. The target protein was visualized by staining with NBT/BCIP substrate for approximately 1 minute.

2.6. Scale-up and Ni AFfinity Chromatography

1 mL of starter culture from two selected constructs was independently transferred to 50 mL of LB media containing 50 g/mL of kanamycin, and protein expression was induced by the addition of 0.5 mM IPTG when the optical density at 600 nm (OD600) reached approximately 0.4-06. Protein synthesis continued for 4 h at 37°C and 300 agitations per minute. The supernatant and cell pellet were then separated by centrifugation and stored at -80 °C until protein purification.

At this stage, to purify brazzein in the periplasm, the previously described osmotic shock process had to be modified to reduce the EDTA-induced chelation of the resin. As a result, an EDTA-free, 50 mM Tris-HCl, pH 8.0 buffer was used as a hypotonic solution. Due to the significant loss in the hypertonic treatment, the two solutions (hypertonic and hypotonic) were combined and subjected to purification after adjusting the NaCl concentration to around 300 mM.

To purify the target protein in the periplasmic extract, first, 10 column volume (CV) buffer A (50 mM Tris-HCl and 300 mM NaCl, pH-8.0) was used to equilibrate the column. Following sample loading, the column was washed with 20 CV of the same buffer. Bound proteins were eluted with 5CV buffer B (250 mM imidazole, 50 mM Tris-HCl, 300 mM NaCl, pH-8.0).

Secreted brazzein was purified without any prior treatment of the culture supernatant following the same purification protocol described above. A schematic view of the experimental design is presented in Fig. (2).

Fig. (2). Schematic view of the work conducted to scale-up expression and purification of recombinant brazzein.

All purification samples were analyzed through 15% Tris-glycine gels [26]. Two parallel gels were run; one was stained with Coomassie R250, while the other was used for western blot analysis. Protein quantification was performed using the Lowry method [27], and the yield of the target protein in the periplasm, supernatant, and cell culture was determined using ImageJ 1.53T [28] based on protein band intensity.

3. RESULTS AND DISCUSSION

3.1. Signal Peptide Selection

As only a few studies have used signal peptides for the periplasmic or secretive brazzein expression in E.coli [29, 30] we decided to use 21 signal peptides to study their ability to direct recombinant brazzein into the periplasm and extracellular space (Table 1). Most of the selected signal peptides belonged to the general secretion (Sec) pathway (17 Sec-dependent-posttranslational pathways and 2 signal recognition particle-dependent -cotranslational pathways), whereas only two were related to the twin-arginine translocation (TAT) pathway. In fact, Sec is predicted to transport more than 90% of all secreted proteins in E.coli [31]. For this reason, signal peptides belonging to the Sec system, along with TAT pathway representatives are widely used in recombinant protein expression [12, 16]. Both pathways, however, belong to the type II secretion system, which transports proteins in two phases: periplasmic translocation and extracellular transport. In the Sec pathway, the cytosolic chaperone SecB or signal recognition particle recognizes an unfolded preprotein and transports it to the corresponding inner membrane-bound protein. The TAT system, in contrast, recognizes a folded preprotein by its complex. In both cases, signal sequences are removed before the protein being released into the periplasm [32, 33]. Mechanisms such as T2SS and T5SS may then transport the proteins from the periplasm to the extracellular environment [34].

Signal peptidases with active sites in the periplasm cut signal peptides before translocation of extracellular proteins; however, if signal peptidases fail to cut signal peptides, the protein will be inactive even if it can pass through the membrane or will end up in the wrong location in the cell [35]. The cleavage efficiency of the selected signal peptides from the correct amino acid residue (Signal peptide - DK...) ranged from 92.24 to 99.78%, indicating a high likelihood of proper processing of the target protein. The signal peptides BglX, FhuD, OmpW, and TorZ were more likely to perform this cut, whereas MalE was the least probable.

In addition, for the selected experimental set, the predicted solubility using the protein-sol platform (Table 1), all sequences were soluble values ranging from 0.513 to 0.758. The highest solubility was observed for PhoA and OmpF meanwhile, FhuD, TorZ and PelB showed the lowest solubility values, though all were still greater than the mean solubility value (0.45), as indicated by Niwa et al. [22]. Because insoluble proteins can accumulate as inclusion bodies, secretory protein solubility may be regarded as the most significant factor in secretion [36]. This criterion did not appear to be a constraining characteristic in our investigation; based on the solubility results of all selected constructs, all of them were chosen for mini-scale expression. The localization prediction, on the other hand, suggested diverse destinations: cytoplasm for three of the constructs, periplasmic space for eight, outer membrane for three, and culture medium for seven.

3.2. Generation of Vector Constructs, Transformation and Selection of Positive Clones

Plasmid pSEVA234 is a vector with 4550 nucleotide pairs and a set of conventional restriction sites enabling easy substitution of its constituent elements [37]. Since the plasmid lacked the RBS site for efficient expression of the target protein under the trc promoter, the RBS motif commonly used for E.coli AGGAGG was inserted into the 5' end of the gene [38]. Previously, 5-8 nucleotides between the RBS and the start codon resulted in considerably more efficient protein expression [39]. As a result, 6 nucleotides were included between the RBS and the start codon of the genes used in this study.

Table 1.
The list of chosen signal peptides for recombinant brazzein expression.
- Construct Name SP Amino Acid Sequence Pathway Type Cleavage Site and Probability Predicted Localization Predicted Solubility
1. PelB_Brazzein MKYLLPTAAAGLLLLAAQPAMA SEC AMA-DK. Pr: 0.9942 Cytoplasmic 0.572
2. PhoA_Brazzein MKQSTIALALLPLLFTPVTKA TKA-DK. Pr: 0.9626 Cytoplasmic 0.641
3. OmpA_Brazzein MKKTAIAIAVALAGFATVAQA AQA-DK. Pr: 0.9725 Periplasm 0.696
4. OmpC_Brazzein MKVKVLSLLVPALLVAGAANA ANA-DK. Pr: 0.9561 Secreted 0.663
5. OmpW_Brazzein MKKLTVAALAVTTLLSGSAFA AFA-DK. Pr: 0.9966 Secreted 0.691
6. OmpF_Brazzein MMKRNILAVIVPALLVAGTANA ANA-DK. Pr: 0.9899 Secreted 0.718
7. LivK_Brazzein MKRNAKTIIAGMIALAISHTAMA AMA-DK. Pr: 0.9892 Periplasm 0.682
8. PhoE_Brazzein MKKSTLALVVMGIVASASVQA VQA-DK. Pr: 0.9897 Secreted 0.758
9. MalE_Brazzein MKIKTGARILALSALTTMMFSASALA ALA-DK. Pr: 0.9224 Periplasm 0.684
10. Btub_Brazzein MIKKASLLTACSVTAFSAWA AWA-DK. Pr: 0.9901 Secreted 0.708
11. FecA_Brazzein MTPLRVFRKTTPLVNTIRLSLLPLAGLSFSAFA AFA-DK. Pr: 0.9864 Outer membrane 0.603
12. HstI_Brazzein MKKNIAFLLASMFVFSIATNAYA AYA-DK. Pr: 0.9735 Secreted 0.684
13. UidC_Brazzein MRKIVAMAVICLTAASGLTSAYA AYA-DK. Pr: 0.9574 Secreted 0.665
14. BglX_Brazzein MKWLCSVGIAVSLALQPALA ALA-DK. Pr: 0.9978 Cytoplasmic 0.627
15. PotD_Brazzein MKKWSRHLLAAGALALGMSAAHA AHA-DK. Pr: 0.9945 Periplasm 0.681
16. OstA_Brazzein MKKRIPTLLATMIATALYSQQGLA GLA-DK. Pr: 0.9330 Outer membrane 0.706
17. IutA_Brazzein MMISKKYTLWALNPLLLTMMAPAVA AVA-DK. Pr: 0.9760 Outer membrane 0.583
18. TolB_Brazzein MKQALRVAFGFLILWASVLHA SRP LHA-DK. Pr: 0.9752 Periplasm 0.633
19. DsbA_Brazzein MKKIWLALAGLVLAFSASA ASA-DK. Pr: 0.9672 Periplasm 0.698
20. TorZ_Brazzein MTLTRREFIKHSGIAAGALVVTSAAPLPAWA TAT AWA-DK. Pr: 0.9963 Periplasm 0.519
21. FhuD_Brazzein MSGLPLISRRRLLTAMALSPLLWQMNTAHA AHA-DK. Pr: 0.9970 Periplasm 0.513
Fig. (3). M - GeneRuler 50 bp DNA Ladder, 1-21 – brazzein constructs, pS – pSEVA234 empty vector.

Transformation of the generated constructs into E.coli NEBExpress strains gave >20 colonies when selected on agar plates based on their ability to grow in an antibiotic medium. PCR analysis from purified plasmids that were extracted from picked colonies confirmed the presence of PCR products between 400 and 500 base pair DNA markers in brazzein constructs, which corresponds to the length of the inserted DNA fragments (Fig. 3).

3.3. Identification of Efficient Signal Peptides for Recombinant Brazzein Expression

High-throughput screening techniques are especially desirable because they expedite the research process and reduce screening expenses. Thus, at this stage, a mini-expression study was conducted for the initial evaluation of the secretive ability of the constructs. In addition, since temperature affects the localization of recombinant proteins in the periplasm and culture media, the expression is conducted under two distinct high and low-temperature conditions. Due to the comparatively rapid expression rate of E.coli cells at 37°C, the recommended expression period is between 2-4 h. In contrast, expression at lower temperatures may be slower, necessitating additional time for optimal target protein output [40, 41]. As a consequence, the level of protein expression was evaluated under two distinct conditions. In the first set of experiments, expression was carried out at 37°C for 4 h, while in the second set, expression was carried out at 25°C for 16 h. The evaluation of protein expression from three sample points: i) culture, ii) supernatant, and iii) periplasm are presented in (Table 2).




Table 2.
Expression evaluation of constructs at two different expression conditions.
- Construct Name 37°C 4 h Induction 25°C 16 h Induction
Culture Supernatant Periplasm Culture Supernatant Periplasm
1. PelB_Brazzein ++ - - + - -
2. PhoA_Brazzein ++ - + + - -
3. OmpA_Brazzein + - - + - -
4. OmpC_Brazzein - - - + - -
5. OmpW_Brazzein - - - + - -
6. OmpF_Brazzein - - - + - -
7. LivK_Brazzein - - - + - -
8. PhoE_Brazzein - - - + - -
9. MalE_Brazzein +++ - + ++ + +
10. Btub_Brazzein +++ - + ++ - +
11. FecA_Brazzein - - - - - -
12. HstI_Brazzein ++++ + + +++ + ++
13. UidC_Brazzein + - - + - -
14. BglX_Brazzein + - - + - -
15. PotD_Brazzein - - - - - -
16. OstA_Brazzein + - - + - -
17. IutA_Brazzein - - - - - -
18. TolB_Brazzein - - - - - -
19. DsbA_Brazzein ++ - - - - +
20. TorZ_Brazzein ++ - - ++ - +
21. FhuD_Brazzein + - - - - -
22. pSEVA - - - - - -
 Note: Empty cells indicate no or nonviable expression and the number of “+” indicates the level of expression.

12 constructs expressed brazzein at 37°C compared to 16 constructs at 25°C. In the first set, four signal peptides resulted in the localization of the target protein in the periplasm, while only HstI led the protein to the nutrient medium. However, when the expression was conducted at a lower temperature, the target protein was localized in the periplasm in 5 constructs and in the supernatant in HstI and MalE constructs. For four signal peptides, the FecA, PotD, IutA and TolB, no detectable level of expression was found in both sets. Hence, a greater proportion of constructs demonstrated detectable expression at the lower temperature, the yield of the target protein was significantly greater at 37°C than at 25°C. The signal peptides PhoA, MalE, BtuB, HstI, FhuD and TorZ could successfully direct recombinant brazzein into periplasmic space, though the localization prediction was cytoplasmic for PhoA_Brazzein. The localization prediction for the secretive signal peptides MalE and HstI were periplasmic and secretive, respectively. Interestingly, MalE had the least cutting probability but still could transport the protein into the medium. As a result, MalE_Brazzein and HstI_Brazzein, the two constructs with secretory ability, were chosen for larger-scale expression and purification.

It was also found that the molecular weight of the target protein in both periplasm and culture supernatant was less than that of the 10-kDa protein standard. This was consistent with the estimated molecular mass of the target protein (7.2 - 7.4 kDa following signal peptide cleavage). In some constructs, we also observed the presence of two bands corresponding to the target protein and its precursor, indicating partial maturation of the target protein. In addition, we witnessed that because brazzein contains four disulfides, the protein had a tendency to aggregate in SDS gel electrophoresis regardless of treatment with beta-mercaptoethanol.

3.4. Larger-scale Expression of the Selected Constructs and Purification by Ni Chromatography

The ability of the histidine amino acid to exhibit a strong affinity for metal ions, such as nickel (Ni), copper (Cu), and cobalt (Co), is extensively employed in the process of purifying recombinant proteins. The tag can be conjugated at either terminus of the protein, and it generally does not impede the normal functioning of the protein [42]. Purification of the target protein through a single chromatographic stage yielded acceptable purity for both periplasmic and supernatant samples (Fig. 4).

Fig. (4). Expression and purification of brazzein from the secretive constructs: MalE_Brazzein: A (staining) and A1 (Western blot). HstI_Brazzein B (staining) and B1 (Western blot). 1 – Culture; 2 – Cell pellet after osmotic shock; 3 – Supernatant after hypertonic solution treatment; 4 – Supernatant after hypotonic solution treatment; 5 – Nonbinding periplasmic proteins in chromatography; 6 – Eluted periplasmic protein; M – mPAGE® Color Protein Standard; S1 – Sample culture media; S2 – Nonbinding secretory proteins in chromatography; S3 – Eluted secreted proteins.

The results suggested that the majority of the target protein remained in the cell pellet following the osmotic shock process (Fig. 4), Line 2). We did not, however, determine if this protein was localized intracellularly (rather than being transported to the periplasm) or if it was in the periplasm and was not released during the osmotic shock process. Therefore, we assume that optimizing the osmotic shock process may increase protein yield, as Ghamghami E et al. (2020) demonstrated that optimizing the four independent variables that influence the TES osmotic shock method could increase the recovery of the anti-G17-Gly scFv antibody fragment [43].

In the samples isolated from the culture supernatant, we observed that the target protein was almost not observed in flowthrough (Fig. 4), Line S2) and wash fractions. This shows that although the nutrient medium was not adjusted before purification, the binding property of the target protein to Ni metal was not affected.

The results showed that the target protein was more abundant in the periplasm than in the culture supernatant. The amount of secreted target protein for MalE_Brazzein and HstI_Brazzein was 3.975±1.5 7.73±2.1 mg/L, respectively (Table 3).

Brazzein is produced intracellularly in E.coli in multiple studies [8, 10, 44, 45]. According to these reports, yield ranged from only several milligrams to approximately 150 mg/L, and the sweetness of brazzein differentiated from not sweet to a similar level of sweetness as wild-type brazzein. We, however, decided to omit sweetness analyses in our study because a prior study reported that recombinant brazzein with C-terminal his-tag lacked sweetness [10]. Additionally, it has been demonstrated that the presence of an intact C-terminus plays a crucial role in the determination of sweet taste [4].

Table 3.
Expression yield in two top constructs.
Names Extracted Periplasmic Brazzein (mg/L) Secreted Brazzein Yield (mg/L)
MalE_Brazzein 11.33±2.9 3.975±1.5
HstI_Brazzein 52.33±7.6 7.73±2.1

On the other hand, only a few studies have investigated the direction of brazzein into the periplasm or the extracellular space in E.coli. For example, Lee et al. (2010) employed the pelB signal peptide and a sophisticated gene optimization technology for brazzein expression and showed that the yield of target protein in the periplasmic space could reach 6.7 mg/L but no other signal peptides were covered [29]. There is also a patent in which the brazzein yield claimed to be from 0.5 g to 5.0 g, where authors used 22 different signal peptides for brazzein expression in the BL21 (DE3) strain [30]. However, their ability to localize recombinant brazzein into different compartments of E.coli was not clarified.

Similar research assessed and characterized the efficacy of brazzein secretion with seven distinct signal peptides in Pichia pastoris and brazzein expression levels varied between 283 mg/L to 345 mg/L for the three most successful signal peptides [46]. The reason for such high yield expression could be the advanced secretion system exhibited by yeasts. On the contrary, the expression of proteins in the secretory pathway of E.coli bacteria is typically characterized by low production yields. Successful cases have only been achieved through the implementation of carefully optimized expression systems, high-density fermentation techniques, appropriate environmental conditions, and other strategic approaches [47-49]. For this reason, we expect optimizing other parameters using similar strategies will significantly increase brazzein secretion.

CONCLUSION

Signal peptides suitable for secretory or periplasmic expression of the brazzein gene in E.coli were screened. Among the selected 21 signal peptides, brazzein conjugated with MalE, BtuB, and HstI signal peptides exhibited the highest levels of brazzein expression. However, only two signal peptides, MalE and HstI, have demonstrated the ability to effectively guide brazzein into the culture media with a target protein yield of 3.975 mg/L and 7.73 mg/L, respectively. The findings can help optimize the expression of recombinant brazzein in E.coli cells and contribute to the development of strategies for targeting proteins. However, in order to develop a feasible technology for large-scale production, it is necessary to include additional optimization strategies.

AUTHORS' CONTRIBUTIONS

MM and TS designed the study, MM, EK and SK conducted the experiments. MM, DD and TS wrote and edited the manuscript.

ETHICS APPROVAL AND CONSENT TO PARTICIPATE

Not applicable.

HUMAN AND ANIMAL RIGHTS

Not applicable.

CONSENT FOR PUBLICATION

Not applicable.

AVAILABILITY OF DATA AND MATERIALS

Not applicable.

FUNDING

The study has been funded by the Science Development Fund of the Ministry of Higher Education, Science and Innovation of the Republic of Uzbekistan within the framework of financing practical projects of young scientists. Project number A IRV – 2021-468.

CONFLICT OF INTEREST

The authors declare no conflict of interest, financial or otherwise.

ACKNOWLEDGEMENTS

This project was financed by the Science Development Fund of the Ministry of Higher Education, Science and Innovation of the Republic of Uzbekistan within the framework of financing practical projects of young scientists.

We also thank the founders and contributors of the SEVA collection for sharing the pSEVA234 plasmid with us at no cost.

REFERENCES

1
Togo J, Hu S, Li M, Niu C, Speakman JR. Impact of dietary sucrose on adiposity and glucose homeostasis in C57BL/6J mice depends on mode of ingestion: Liquid or solid. Mol Metab 2019; 27: 22-32.
2
Bhupathiraju SN, Hu FB. Epidemiology of obesity and diabetes and their cardiovascular complications. Circ Res 2016; 118(11): 1723-35.
3
Ming D, Hellekant G. Brazzein, a new high‐potency thermostable sweet protein from Pentadiplandra brazzeana B. FEBS Lett 1994; 355(1): 106-8.
4
Assadi-Porter FM, Aceti DJ, Markley JL. Sweetness determinant sites of brazzein, a small, heat-stable, sweet-tasting protein. Arch Biochem Biophys 2000; 376(2): 259-65.
5
Neiers F, Naumer C, Krohn M, Briand L. The recent development of a sweet-tasting brazzein and its potential industrial applications. In: Merillon J-M, Ramawat KG, Eds. Sweeteners: Pharmacology, Biotechnology, and Applications. Cham: Reference Series in Phytochemistry; Springer International Publishing 2017; pp. 1-20.
6
Assadi-Porter FM, Maillet EL, Radek JT, Quijada J, Markley JL, Max M. Key amino acid residues involved in multi-point binding interactions between brazzein, a sweet protein, and the T1R2-T1R3 human sweet receptor. J Mol Biol 2010; 398(4): 584-99.
7
Dittli SM, Rao H, Tonelli M, et al. Structural role of the terminal disulfide bond in the sweetness of brazzein. Chem Senses 2011; 36(9): 821-30.
8
Assadi-Porter FM, Aceti DJ, Cheng H, Markley JL. Efficient production of recombinant brazzein, a small, heat-stable, sweet-tasting protein of plant origin. Arch Biochem Biophys 2000; 376(2): 252-8.
9
Denoncin K, Collet JF. Disulfide bond formation in the bacterial periplasm: major achievements and challenges ahead. Antioxid Redox Signal 2013; 19(1): 63-71.
10
Jafarian V, Bagheri K, Zarei J, Karami S, Ghanavatian P. Improved expression of recombinant sweet-tasting brazzein using codon optimization and host change as new strategies. Food Biotechnol 2020; 34(1): 62-76.
11
Hatahet F, Nguyen VD, Salo KEH, Ruddock LW. Disruption of reducing pathways is not essential for efficient disulfide bond formation in the cytoplasm of E. coli. Microb Cell Fact 2010; 9(1): 67.
12
Mergulhão FJM, Summers DK, Monteiro GA. Recombinant protein secretion in Escherichia coli. Biotechnol Adv 2005; 23(3): 177-202.
13
Yoon S, Kim S, Kim J. Secretory production of recombinant proteins in Escherichia coli. Recent Pat Biotechnol 2010; 4(1): 23-9.
14
Jung ST, Kang TH, Kelton W, Georgiou G. Bypassing glycosylation: Engineering aglycosylated full-length IgG antibodies for human therapy. Curr Opin Biotechnol 2011; 22(6): 858-67.
15
Nelson AL, Reichert JM. Development trends for therapeutic antibody fragments. Nat Biotechnol 2009; 27(4): 331-7.
16
Kleiner-Grote GRM, Risse JM, Friehs K. Secretion of recombinant proteins from E. coli. Eng Life Sci 2018; 18(8): 532-50.
17
Santos BD, Morones-Ramirez JR, Balderas-Renteria I, Casillas-Vega NG, Galbraith DW, Zarate X. Optimizing periplasmic expression in escherichia coli for the production of recombinant proteins tagged with the small metal-binding protein SmbP. Mol Biotechnol 2019; 61(6): 451-60.
18
Selas Castiñeiras T, Williams SG, Hitchcock A, Cole JA, Smith DC, Overton TW. Development of a generic β-lactamase screening system for improved signal peptides for periplasmic targeting of recombinant proteins in Escherichia coli. Sci Rep 2018; 8(1): 6986.
19
Almagro Armenteros JJ, Tsirigos KD, Sønderby CK, et al. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat Biotechnol 2019; 37(4): 420-3.
20
ProtComp-Predict the sub-cellular localization of bacterial proteins. Available from:http://www.softberry.com/berry.phtml?topic=pcompb&group=programs&subgroup=proloc (Accessed on: Sep 24, 2022).
21
Hebditch M, Carballo-Amador MA, Charonis S, Curtis R, Warwicker J. Protein–Sol: A web tool for predicting protein solubility from sequence. Bioinformatics 2017; 33(19): 3098-100.
22
Niwa T, Ying BW, Saito K, et al. Bimodal protein solubility distribution revealed by an aggregation analysis of the entire ensemble of Escherichia coli proteins. Proc Natl Acad Sci USA 2009; 106(11): 4201-6.
23
Codon optimization tool makes synthetic gene design easy. Available from:https://www.idtdna.com/pages/education/decoded/article/codon-optimization-tool-makes-synthetic-gene-design-easy (Accessed on: Sep 24, 2022).
24
Addgene: Protocol-bacterial transformation. Available from:https://www.addgene.org/protocols/bacterial-transformation/ (Accessed on: Sep 10, 2023).
25
PCR Using Q5® High-Fidelity DNA Polymerase (M0491)-NEB Available from:https://international.neb.com/protocols/2013/12/13/pcr-using-q5-high-fidelity-dna-polymerase-m0491 (Accessed on: Sep 10, 2023).
26
Laemmli UK. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 1970; 227(5259): 680-5.
27
Lowry O, Rosebrough N, Farr AL, Randall R. Protein measurement with the Folin phenol reagent. J Biol Chem 1951; 193(1): 265-75.
28
Schneider CA, Rasband WS, Eliceiri KW. NIH Image to ImageJ: 25 years of image analysis. Nat Methods 2012; 9(7): 671-5.
29
Lee JJ, Kong JN, Do HD, Jo DH, Kong KH. Design and efficient soluble expression of a sweet protein, brazzein and minor-form mutant. Bull Korean Chem Soc 2010; 31(12): 3830-3.
30
Dukkipati A, Balagangadhar AV. Process for extracellular secretion of brazzein. WO2017130222A9, 2017.
31
Georgiou G, Segatori L. Preparative expression of secreted proteins in bacteria: Status report and future prospects. Curr Opin Biotechnol 2005; 16(5): 538-45.
32
du Plessis DJF, Nouwen N, Driessen AJM. The Sec translocase. Biochim Biophys Acta Biomembr 2011; 1808(3): 851-65.
33
Palmer T, Berks BC. The twin-arginine translocation (Tat) protein export pathway. Nat Rev Microbiol 2012; 10(7): 483-96.
34
Green E R, Mecsas J. Bacterial secretion systems: An overview. Microbiol Spectr 2016; 4(1): 4.1.13.
35
Paetzel M, Karla A, Strynadka NCJ, Dalbey RE. Signal peptidases. Chem Rev 2002; 102(12): 4549-80.
36
Chang CCH, Song J, Tey BT, Ramanan RN. Bioinformatics approaches for improved recombinant protein production in Escherichia coli: Protein solubility prediction. Brief Bioinform 2014; 15(6): 953-62.
37
Home - SEVA plasmids - Standard European Vector Architecture. Available from:https://seva-plasmids.com/ (Accessed on: Dec 27, 2022).
38
rClone: A synthetic biology tool that enables the research of bacterial translation. Available from:https://www.jyi.org/2017-march/2017/5/1/rclone-a-synthetic-biology-tool-that-enables-the-research-of-bacterial-translation (Accessed on: Dec 27, 2022).
39
Chen H, Bjerknes M, Kumar R, Jay E. Determination of the optimal aligned spacing between the Shine-Dalgarno sequence and the translation initiation codon of Escherichia coli m RNAs. Nucleic Acids Res 1994; 22(23): 4953-7.
40
Niiranen L, Espelid S, Karlsen CR, et al. Comparative expression study to increase the solubility of cold adapted Vibrio proteins in Escherichia coli. Protein Expr Purif 2007; 52(1): 210-8.
41
Tips for Optimizing Protein Expression and Purification-Rockland. Available from:https://www.rockland.com/resources/tips-for-optimizing-protein-expression-and-purification/ (Accessed on: Dec 27, 2022).
42
Bornhorst JA, Falke JJ. Purification of proteins using polyhistidine affinity tags. Methods Enzymol 2000; 326: 245-54.
43
Ghamghami E, Abri Aghdam M, Tohidkia MR, et al. Optimization of Tris/EDTA/Sucrose (TES) periplasmic extraction for the recovery of functional scFv antibodies. AMB Express 2020; 10(1): 129.
44
Berlec A, Jevnikar Z, Majhenič AČ, Rogelj I, Štrukelj B. Expression of the sweet-tasting plant protein brazzein in Escherichia coli and Lactococcus lactis: a path toward sweet lactic acid bacteria. Appl Microbiol Biotechnol 2006; 73(1): 158-65.
45
Assadi-Porter FM, Patry S, Markley JL. Efficient and rapid protein expression and purification of small high disulfide containing sweet protein brazzein in E. coli. Protein Expr Purif 2008; 58(2): 263-8.
46
Neiers F, Belloir C, Poirier N, Naumer C, Krohn M, Briand L. Comparison of Different Signal Peptides for the Efficient Secretion of the Sweet-Tasting Plant Protein Brazzein in Pichia pastoris. Life (Basel) 2021; 11(1): 46.
47
Joly JC, Leung WS, Swartz JR. Overexpression of Escherichia coli oxidoreductases increases recombinant insulin-like growth factor-I accumulation. Proc Natl Acad Sci USA 1998; 95(6): 2773-7.
48
Choi JH, Jeong KJ, Kim SC, Lee SY. Efficient secretory production of alkaline phosphatase by high cell density culture of recombinant Escherichia coli using the Bacillus sp. endoxylanase signal sequence. Appl Microbiol Biotechnol 2000; 53(6): 640-5.
49
Rennig M, Martinez V, Mirzadeh K, et al. TARSyn: Tunable Antibiotic Resistance Devices Enabling Bacterial Synthetic Evolution and Protein Production. ACS Synth Biol 2018; 7(2): 432-42.